Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008780-M02A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008780-M02A, RRID:AB_10754258
- Product name
- RIOK3 monoclonal antibody (M02A), clone 3G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RIOK3.
- Antigen sequence
NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRN
VSQKGGVKEALSERELFNAVSGLNITADNEADFLA
EIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYD
E- Isotype
- IgG
- Antibody clone number
- 3G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RIOK3 monoclonal antibody (M02A), clone 3G11 Western Blot analysis of RIOK3 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RIOK3 expression in transfected 293T cell line by RIOK3 monoclonal antibody (M02A), clone 3G11.Lane 1: RIOK3 transfected lysate(59.1 KDa).Lane 2: Non-transfected lysate.