Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405609 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC9A8 antibody: synthetic peptide directed towards the middle region of human SLC9A8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEV
RQGPS GSEDDEQELL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Familial pure proximal renal tubular acidosis--a clinical and genetic study.
Katzir Z, Dinour D, Reznik-Wolf H, Nissenkorn A, Holtzman E
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Apr;23(4):1211-5
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Apr;23(4):1211-5
No comments: Submit comment
No validations: Submit validation data