Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501832 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ceramide Synthase 2 (CERS2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAK
ASDLY ITLPLALLFL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of ceramide synthase 2: tissue distribution, substrate specificity, and inhibition by sphingosine 1-phosphate.
Laviad EL, Albee L, Pankova-Kholmyansky I, Epstein S, Park H, Merrill AH Jr, Futerman AH
The Journal of biological chemistry 2008 Feb 29;283(9):5677-84
The Journal of biological chemistry 2008 Feb 29;283(9):5677-84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting