Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405916 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Lysosomal Protein Transmembrane 4 beta (LAPTM4B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIIL
LFISI ILTFKGYLIS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Relationship between LAPTM4B gene polymorphism and susceptibility of colorectal and esophageal cancers.
Cheng XJ, Xu W, Zhang QY, Zhou RL
Annals of oncology : official journal of the European Society for Medical Oncology / ESMO 2008 Mar;19(3):527-32
Annals of oncology : official journal of the European Society for Medical Oncology / ESMO 2008 Mar;19(3):527-32
No comments: Submit comment
No validations: Submit validation data