Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406224 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Thioesterase 12 (ACOT12) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACOT12 antibody: synthetic peptide directed towards the middle region of human ACOT12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
VNNTF QTCVEVGVRV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of StARD3 as a lutein-binding protein in the macula of the primate retina.
Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
Li B, Vachali P, Frederick JM, Bernstein PS
Biochemistry 2011 Apr 5;50(13):2541-9
Biochemistry 2011 Apr 5;50(13):2541-9
Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
Hunt MC, Rautanen A, Westin MA, Svensson LT, Alexson SE
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2006 Sep;20(11):1855-64
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2006 Sep;20(11):1855-64
No comments: Submit comment
No validations: Submit validation data