ABIN504464
antibody from antibodies-online
Targeting: CCR2
CC-CKR-2, CD192, CKR2, CMKBR2, FLJ78302, MCP-1-R
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504464 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-C Motif) Receptor 2 (CCR2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMI
VYFLF WTPYNIVILL- Vial size
- 50 µg
Submitted references A novel network pharmacology approach to analyse traditional herbal formulae: the Liu-Wei-Di-Huang pill as a case study.
Host genetic influences on highly active antiretroviral therapy efficacy and AIDS-free survival.
Liang X, Li H, Li S
Molecular bioSystems 2014 May;10(5):1014-22
Molecular bioSystems 2014 May;10(5):1014-22
Host genetic influences on highly active antiretroviral therapy efficacy and AIDS-free survival.
Hendrickson SL, Jacobson LP, Nelson GW, Phair JP, Lautenberger J, Johnson RC, Kingsley L, Margolick JB, Detels R, Goedert JJ, O'Brien SJ
Journal of acquired immune deficiency syndromes (1999) 2008 Jul 1;48(3):263-71
Journal of acquired immune deficiency syndromes (1999) 2008 Jul 1;48(3):263-71
No comments: Submit comment
No validations: Submit validation data