Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503506 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acetyl-CoA Acetyltransferase 1 (ACAT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACAT1 antibody: synthetic peptide directed towards the middle region of human ACAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKE
DEEYK RVDFSKVPKL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references [Analysis of acyl-coenzyme A: cholesterol acyltransferase 1 polymorphism in patients with endogenous hypertriglyceridemia in Chinese population].
Li Q, Bai H, Fan P
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2008 Apr;25(2):206-10
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2008 Apr;25(2):206-10
No comments: Submit comment
No validations: Submit validation data