Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405724 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acid Phosphatase 2, Lysosomal (ACP2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACP2 antibody: synthetic peptide directed towards the middle region of human ACP2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNE
SSRNA QFLDMVANET- Vial size
- 50 µg
Submitted references Identification of a novel risk locus for progressive supranuclear palsy by a pooled genomewide scan of 500,288 single-nucleotide polymorphisms.
Melquist S, Craig DW, Huentelman MJ, Crook R, Pearson JV, Baker M, Zismann VL, Gass J, Adamson J, Szelinger S, Corneveaux J, Cannon A, Coon KD, Lincoln S, Adler C, Tuite P, Calne DB, Bigio EH, Uitti RJ, Wszolek ZK, Golbe LI, Caselli RJ, Graff-Radford N, Litvan I, Farrer MJ, Dickson DW, Hutton M, Stephan DA
American journal of human genetics 2007 Apr;80(4):769-78
American journal of human genetics 2007 Apr;80(4):769-78
No comments: Submit comment
No validations: Submit validation data