Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406685 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKK
IEEVV ERANNTRYGL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
Luo P, Wang A, Payne KJ, Peng H, Wang JG, Parrish YK, Rogerio JW, Triche TJ, He Q, Wu L
Stem cells (Dayton, Ohio) 2007 Oct;25(10):2628-37
Stem cells (Dayton, Ohio) 2007 Oct;25(10):2628-37
No comments: Submit comment
No validations: Submit validation data