Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN150398 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Breast Cancer 1 (BRCA1) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: QQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE DLRNPEQSTSEKAV, corresponding to amino acids 1395-1454 of Human BRCA1.
- Description
- Immunogen affinity purified
- Reactivity
- Human
- Host
- Chicken/Avian
- Vial size
- 50 μg
- Concentration
- 1 mg/ml
No comments: Submit comment
No validations: Submit validation data