Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503882 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALDH18A1 antibody: synthetic peptide directed towards the N terminal of human ALDH18A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKH
AKRIV VKLGSAVVTR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Delta1-pyrroline-5-carboxylate synthase deficiency: neurodegeneration, cataracts and connective tissue manifestations combined with hyperammonaemia and reduced ornithine, citrulline, arginine and proline.
Baumgartner MR, Rabier D, Nassogne MC, Dufier JL, Padovani JP, Kamoun P, Valle D, Saudubray JM
European journal of pediatrics 2005 Jan;164(1):31-6
European journal of pediatrics 2005 Jan;164(1):31-6
No comments: Submit comment
No validations: Submit validation data