Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184223 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cholinergic Receptor, Nicotinic, delta (Muscle) (CHRND) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNK
ELRPV AHKEESVDVA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references New mutations in acetylcholine receptor subunit genes reveal heterogeneity in the slow-channel congenital myasthenic syndrome.
Engel AG, Ohno K, Milone M, Wang HL, Nakano S, Bouzat C, Pruitt JN 2nd, Hutchinson DO, Brengman JM, Bren N, Sieb JP, Sine SM
Human molecular genetics 1996 Sep;5(9):1217-27
Human molecular genetics 1996 Sep;5(9):1217-27
No comments: Submit comment
No validations: Submit validation data