Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182602 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-GATA Binding Protein 3 (GATA3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSR
HMSSL SHISPFSHSS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references GATA-3 suppresses IFN-gamma promoter activity independently of binding to cis-regulatory elements.
Identification of isoamylase, a glycogen-debranching enzyme, from Bacillus amyloliquefaciens.
Kaminuma O, Kitamura F, Kitamura N, Miyagishi M, Taira K, Yamamoto K, Miura O, Miyatake S
FEBS letters 2004 Jul 16;570(1-3):63-8
FEBS letters 2004 Jul 16;570(1-3):63-8
Identification of isoamylase, a glycogen-debranching enzyme, from Bacillus amyloliquefaciens.
Urlaub H, Wöber G
FEBS letters 1975 Sep 1;57(1):1-4
FEBS letters 1975 Sep 1;57(1):1-4
No comments: Submit comment
No validations: Submit validation data