Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311694 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVL
NEEQT QFLKELVEPV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress.
Loss of heterozygosity of 17p13, with possible involvement of ACADVL and ALOX15B, in the pathogenesis of adrenocortical tumors.
Yoon SW, Kang S, Ryu SE, Poo H
Cell proliferation 2010 Dec;43(6):584-93
Cell proliferation 2010 Dec;43(6):584-93
Loss of heterozygosity of 17p13, with possible involvement of ACADVL and ALOX15B, in the pathogenesis of adrenocortical tumors.
Soon PS, Libe R, Benn DE, Gill A, Shaw J, Sywak MS, Groussin L, Bertagna X, Gicquel C, Bertherat J, McDonald KL, Sidhu SB, Robinson BG
Annals of surgery 2008 Jan;247(1):157-64
Annals of surgery 2008 Jan;247(1):157-64
No comments: Submit comment
No validations: Submit validation data