Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310715 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the middle region of human ECHS1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPV
ETLVE EAIQCAEKIA- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
Bruneel A, Labas V, Mailloux A, Sharma S, Royer N, Vinh J, Pernet P, Vaubourdolle M, Baudin B
Proteomics 2005 Oct;5(15):3876-84
Proteomics 2005 Oct;5(15):3876-84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting