Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311108 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAP2K2 antibody: synthetic peptide directed towards the C terminal of human MAP2K2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCK
TLRLN QPGTPTRTAV- Vial size
- 50 µg
Submitted references Phase I pharmacokinetic and pharmacodynamic study of the oral, small-molecule mitogen-activated protein kinase kinase 1/2 inhibitor AZD6244 (ARRY-142886) in patients with advanced cancers.
Adjei AA, Cohen RB, Franklin W, Morris C, Wilson D, Molina JR, Hanson LJ, Gore L, Chow L, Leong S, Maloney L, Gordon G, Simmons H, Marlow A, Litwiler K, Brown S, Poch G, Kane K, Haney J, Eckhardt SG
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 May 1;26(13):2139-46
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 May 1;26(13):2139-46
No comments: Submit comment
No validations: Submit validation data