Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183175 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cation Channel, Sperm Associated 2 (CATSPER2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the C terminal of human CATSPER2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKK
LQEFA VQALMNLEDK- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A voltage-gated ion channel expressed specifically in spermatozoa.
Quill TA, Ren D, Clapham DE, Garbers DL
Proceedings of the National Academy of Sciences of the United States of America 2001 Oct 23;98(22):12527-31
Proceedings of the National Academy of Sciences of the United States of America 2001 Oct 23;98(22):12527-31
No comments: Submit comment
No validations: Submit validation data