Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184105 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Frizzled Family Receptor 9 (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRC
GPGVE VFWSRRDKDF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1.
Restoration of Wnt-7a expression reverses non-small cell lung cancer cellular transformation through frizzled-9-mediated growth inhibition and promotion of cell differentiation.
Tennis MA, Van Scoyk M, Heasley LE, Vandervest K, Weiser-Evans M, Freeman S, Keith RL, Simpson P, Nemenoff RA, Winn RA
Neoplasia (New York, N.Y.) 2010 Mar;12(3):244-53
Neoplasia (New York, N.Y.) 2010 Mar;12(3):244-53
Restoration of Wnt-7a expression reverses non-small cell lung cancer cellular transformation through frizzled-9-mediated growth inhibition and promotion of cell differentiation.
Winn RA, Marek L, Han SY, Rodriguez K, Rodriguez N, Hammond M, Van Scoyk M, Acosta H, Mirus J, Barry N, Bren-Mattison Y, Van Raay TJ, Nemenoff RA, Heasley LE
The Journal of biological chemistry 2005 May 20;280(20):19625-34
The Journal of biological chemistry 2005 May 20;280(20):19625-34
No comments: Submit comment
No validations: Submit validation data