Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 05-957 - Provider product page

- Provider
- EMD Millipore
- Proper citation
- Millipore Cat#05-957, RRID:AB_11214440
- Product name
- Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal
- Antibody type
- Monoclonal
- Antigen
- synthetic peptide corresponding to rat Erk1, amino acids 346-380 (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP)
- Reactivity
- Mouse, Rat
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100 µL
- Storage
- 2 years at -20°C from date of shipment
No comments: Submit comment
No validations: Submit validation data