05-957

antibody from EMD Millipore

Targeting: MAPK1 ERK, ERK2, MAPK2, p41mapk, PRKM1, PRKM2

Western blot

Immunoprecipitation

Antibody data

Submit

Validation data

Product number: 05-957 - Provider product page
Provider: EMD Millipore
Proper citation: Millipore Cat#05-957, RRID:AB_11214440
Product name: Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal
Antibody type: Monoclonal
Antigen: synthetic peptide corresponding to rat Erk1, amino acids 346-380 (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP)
Reactivity: Mouse, Rat
Host: Rabbit
Isotype: IgG
Vial size: 100 µL
Storage: 2 years at -20°C from date of shipment

MAPK1 protein structure - 05-957 shown in red.