Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004082-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004082-M06, RRID:AB_530116
- Product name
- MARCKS monoclonal antibody (M06), clone 2C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MARCKS.
- Antigen sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQEN
GHVKVNGDASPAAAESGAKEELQANGSAP- Isotype
- IgG
- Antibody clone number
- 2C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MARCKS monoclonal antibody (M06), clone 2C2. Western Blot analysis of MARCKS expression in Raw 264.7. (The predicted M.W. of MARCKS is 29 to 39 KDa, but it seems the actual M.W. in vivo is between 68 to 90 KDa in different species. http://www.pnas.org/content/88/6/2505.full.pdf , http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=177061)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MARCKS is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MARCKS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol