Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000663 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000663, RRID:AB_1078192
- Product name
- Anti-ARG2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQ
GQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD
LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSR
AVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV
WVDAHAD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production.
Arginase Inhibition Improves Endothelial Function in Patients With Coronary Artery Disease and Type 2 Diabetes Mellitus
Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats
Gonon AT, Jung C, Katz A, Westerblad H, Shemyakin A, Sjöquist PO, Lundberg JO, Pernow J
PloS one 2012;7(7):e42038
PloS one 2012;7(7):e42038
Arginase Inhibition Improves Endothelial Function in Patients With Coronary Artery Disease and Type 2 Diabetes Mellitus
Shemyakin A, Kovamees O, Rafnsson A, Bohm F, Svenarud P, Settergren M, Jung C, Pernow J
Circulation 2012 December;126(25):2943-2950
Circulation 2012 December;126(25):2943-2950
Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats
Gronros J, Jung C, Lundberg J, Cerrato R, Ostenson C, Pernow J
AJP: Heart and Circulatory Physiology 2011 March;300(4)
AJP: Heart and Circulatory Physiology 2011 March;300(4)
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human prostate and testis tissues using Anti-ARG2 antibody. Corresponding ARG2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN
