Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021560 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021560, RRID:AB_1854586
- Product name
- Anti-NPLOC4
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDV
DKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTF
SISQNPFPIENRDVLGETQDFHSLATYLSQNTSSV
FLDTISDFHLLLFLVTNE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references DVC1 (C1orf124) recruits the p97 protein segregase to sites of DNA damage
Davis E, Lachaud C, Appleton P, Macartney T, Näthke I, Rouse J
Nature Structural & Molecular Biology 2012 October;19(11):1093-1100
Nature Structural & Molecular Biology 2012 October;19(11):1093-1100
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-NPLOC4 antibody HPA021560 (A) shows similar pattern to independent antibody HPA023295 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN