Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406732 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVY
GMDPE LLSMVPRPVC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
Lim J, Hao T, Shaw C, Patel AJ, Szabó G, Rual JF, Fisk CJ, Li N, Smolyar A, Hill DE, Barabási AL, Vidal M, Zoghbi HY
Cell 2006 May 19;125(4):801-14
Cell 2006 May 19;125(4):801-14
No comments: Submit comment
No validations: Submit validation data