Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003881 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003881, RRID:AB_1855020
- Product name
- Anti-PBX1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNK
RIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQ
ANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDS
YQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQ
MYSP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Copy number aberrations of genes regulating normal thymus development in thymic epithelial tumors.
Petrini I, Wang Y, Zucali PA, Lee HS, Pham T, Voeller D, Meltzer PS, Giaccone G
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Apr 15;19(8):1960-71
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Apr 15;19(8):1960-71
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400918)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells.
- Sample type
- HUMAN