HPA001922

antibody from Atlas Antibodies

Targeting: RAP1GAP KIAA0474, RAP1GA1, RAP1GAP1, RAP1GAPII

Antibody data

Submit

Validation data

Product number: HPA001922 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001922, RRID:AB_1079743
Product name: Anti-RAP1GAP
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSE NSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSS SASSFASVVEETEGVDGEDTGLESVSSSGTP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RAP1GAP protein structure - HPA001922 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong positivity in distal tubules and Bowman's capsule.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse midbrain shows strong immunoreactivity in locus coeruleus neurons.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows cytoplasmic positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse cingulate cortex shows strong cytoplasmic positivity in neuronal cell bodies and proximal dendrites.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse hypothalamus shows positivity in neuronal cell bodies and processes in the lateral preoptic area.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse globus pallidus shows strong cytoplasmic immunoreactivity in neurons.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse hippocampus shows cytoplasmic positivity in a subset of interneurons in the CA1 area.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic immunoreactivity in Purkinje cells and neurons in the molecular layer.
Sample type: HUMAN