Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406390 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IGFBP2 antibody: synthetic peptide directed towards the middle region of human IGFBP2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLE
EPKKL RPPPARTPCQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic analysis of recently identified type 2 diabetes loci in 1,638 unselected patients with type 2 diabetes and 1,858 control participants from a Norwegian population-based cohort (the HUNT study).
Hertel JK, Johansson S, Raeder H, Midthjell K, Lyssenko V, Groop L, Molven A, Njølstad PR
Diabetologia 2008 Jun;51(6):971-7
Diabetologia 2008 Jun;51(6):971-7
No comments: Submit comment
No validations: Submit validation data