HPA018322

antibody from Atlas Antibodies

Targeting: TOX KIAA0808, TOX1

Western blot

Antibody data

Submit

Validation data

Product number: HPA018322 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018322, RRID:AB_1858199
Product name: Anti-TOX
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQD YVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVH LNEVESGYHSLCHPMNHNGLLPFHPQN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TOX protein structure - HPA018322 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and liver tissues using HPA018322 antibody. Corresponding TOX RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows nuclear positivity in islets of Langerhans.
Sample type: HUMAN