Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003245 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003245, RRID:AB_1078083
- Product name
- Anti-ABLIM3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESE
YWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSG
IGRLILKEEMKARSSSYADPWTPPRSSTSSREALH
TAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRR
NGLHRT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers.
miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Lee J, Jeong S, Lee CR, Ku CR, Kang SW, Jeong JJ, Nam KH, Shin DY, Chung WY, Lee EJ, Jo YS
Medicine 2015 Jun;94(25):e998
Medicine 2015 Jun;94(25):e998
miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics
Cao J, Shen Y, Zhu L, Xu Y, Zhou Y, Wu Z, Li Y, Yan X, Zhu X
Nature Cell Biology 2012 June;14(7):697-706
Nature Cell Biology 2012 June;14(7):697-706
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Li A, Ponten F, dos Remedios C
PROTEOMICS 2012 January;12(2):203-225
PROTEOMICS 2012 January;12(2):203-225
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN