HPA016750

antibody from Atlas Antibodies

Targeting: XIRP1 CMYA1, DKFZp451D042, Xin

Antibody data

Submit

Validation data

Product number: HPA016750 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016750, RRID:AB_1858884
Product name: Anti-XIRP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QSCTWMFKPQPVDRPVGSREQHLQVSQVPAGERQT DRHVFETEPLQASGRPCGRRPVRYCSRVEIPSGQV SRQKEVFQALEAGKKEEQEPRVIAGSIPAGSVHKF T
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

XIRP1 protein structure - HPA016750 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-XIRP1 antibody. Corresponding XIRP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, heart muscle, liver and testis using Anti-XIRP1 antibody HPA016750 (A) shows similar protein distribution across tissues to independent antibody HPA018458 (B).
Antibody #2 product nr: HPA018458
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-XIRP1 antibody HPA016750.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-XIRP1 antibody HPA016750.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-XIRP1 antibody HPA016750.
Sample type: HUMAN