HPA003742
antibody from Atlas Antibodies
Targeting: DYNC1H1
CMT2O, DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003742 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003742, RRID:AB_1078713
- Product name
- Anti-DYNC1H1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNL
PIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAE
DKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITN
QVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQS
QR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Kinetochore motors drive congression of peripheral polar chromosomes by overcoming random arm-ejection forces
Barisic M, Aguiar P, Geley S, Maiato H
Nature Cell Biology 2014 November;16(12):1249-1256
Nature Cell Biology 2014 November;16(12):1249-1256
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in basal cells of the seminiferus ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN