Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002832 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002832, RRID:AB_1080615
- Product name
- Anti-DCTPP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVA
LAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK
YTELPHGAISEDQAVGPADIPCDS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Comparative proteomics analysis of gastric cancer stem cells.
Triptolide Directly Inhibits dCTP Pyrophosphatase
Morisaki T, Yashiro M, Kakehashi A, Inagaki A, Kinoshita H, Fukuoka T, Kasashima H, Masuda G, Sakurai K, Kubo N, Muguruma K, Ohira M, Wanibuchi H, Hirakawa K
PloS one 2014;9(11):e110736
PloS one 2014;9(11):e110736
Triptolide Directly Inhibits dCTP Pyrophosphatase
Corson T, Cavga H, Aberle N, Crews C
ChemBioChem 2011 July;12(11):1767-1773
ChemBioChem 2011 July;12(11):1767-1773
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and DCTPP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411367).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic and nuclear positivity in glandular cells.
- Sample type
- HUMAN