Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030267 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030267, RRID:AB_10610004
- Product name
- Anti-LGR4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADE
EDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNL
PRVKD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references LGR4 and LGR6 are differentially expressed and of putative tumor biological significance in gastric carcinoma
Steffen J, Simon E, Warneke V, Balschun K, Ebert M, Röcken C
Virchows Archiv 2012 October;461(4):355-365
Virchows Archiv 2012 October;461(4):355-365
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong positivity in glandular cells.
- Sample type
- HUMAN