Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003404 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003404, RRID:AB_1079466
- Product name
- Anti-NDUFV2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVL
QVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPC
MLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVE
CLGACVNAPMVQINDNYYEDLTAKDIEE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
A novel PGC-1α isoform in brain localizes to mitochondria and associates with PINK1 and VDAC.
Desmurs M, Foti M, Raemy E, Vaz FM, Martinou JC, Bairoch A, Lane L
Molecular and cellular biology 2015 Apr;35(7):1139-56
Molecular and cellular biology 2015 Apr;35(7):1139-56
A novel PGC-1α isoform in brain localizes to mitochondria and associates with PINK1 and VDAC.
Choi J, Batchu VV, Schubert M, Castellani RJ, Russell JW
Biochemical and biophysical research communications 2013 Jun 14;435(4):671-7
Biochemical and biophysical research communications 2013 Jun 14;435(4):671-7
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in mitochondria in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate positivity in mitochondria in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissues shows no positivity in fibroblasts.
- Sample type
- HUMAN