18-272-195853

antibody from GenWay

Targeting: IL21R CD360

ELISA

Immunohistochemistry

Flow cytometry

Antibody data

Submit

Validation data

Product number: 18-272-195853 - Provider product page
Provider: GenWay
Product name: IL21-R
Antibody type: Polyclonal
Antigen: Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.
Description: Immunogen affinity purified
Reactivity: Mouse
Host: Rabbit
Isotype: IgG
Vial size: 0.05 mg
Storage: Keep as concentrated solution. Store at 4C short term. For extended storage aliquot and store at -20C or below. Avoid freeze-thaw cycles.

IL21R protein structure - 18-272-195853 shown in red.