Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034487 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA034487, RRID:AB_10795354
- Product name
- Anti-FOXR2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQK
DEGSNCSEDKVVESLPSSSSEQSPLQKQGIHS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Forward genetic screen for malignant peripheral nerve sheath tumor formation identifies new genes and pathways driving tumorigenesis
Rahrmann E, Watson A, Keng V, Choi K, Moriarity B, Beckmann D, Wolf N, Sarver A, Collins M, Moertel C, Wallace M, Gel B, Serra E, Ratner N, Largaespada D
Nature Genetics 2013 May;45(7):756-766
Nature Genetics 2013 May;45(7):756-766
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in a subset of cells in exocrine pancreas.
- Sample type
- HUMAN