Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182448 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and BTB Domain Containing 48 (ZBTB48) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the N terminal of human ZBTB48
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGL
VFKAH WSVLACCSHF- Vial size
- 50 µg
Submitted references Induction of the transcriptional repressor ZBTB4 in prostate cancer cells by drug-induced targeting of microRNA-17-92/106b-25 clusters.
Cloning, chromosomal localization, physical mapping, and genomic characterization of HKR3.
Kim K, Chadalapaka G, Pathi SS, Jin UH, Lee JS, Park YY, Cho SG, Chintharlapalli S, Safe S
Molecular cancer therapeutics 2012 Sep;11(9):1852-62
Molecular cancer therapeutics 2012 Sep;11(9):1852-62
Cloning, chromosomal localization, physical mapping, and genomic characterization of HKR3.
Maris JM, Jensen SJ, Sulman EP, Beltinger CP, Gates K, Allen C, Biegel JA, Brodeur GM, White PS
Genomics 1996 Jul 15;35(2):289-98
Genomics 1996 Jul 15;35(2):289-98
No comments: Submit comment
No validations: Submit validation data