Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008539-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008539-M01, RRID:AB_605937
- Product name
- API5 monoclonal antibody (M01), clone 1C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant API5.
- Antigen sequence
GEALKTEENKIKVVALKITNNINVLIKDLFHIPPS
YKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKS
SAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK- Isotype
- IgG
- Antibody clone number
- 1C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Api5 contributes to E2F1 control of the G1/S cell cycle phase transition.
Garcia-Jove Navarro M, Basset C, Arcondéguy T, Touriol C, Perez G, Prats H, Lacazette E
PloS one 2013;8(8):e71443
PloS one 2013;8(8):e71443
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- API5 monoclonal antibody (M01), clone 1C2 Western Blot analysis of API5 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged API5 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
