Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406677 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMARCD1 antibody: synthetic peptide directed towards the middle region of human SMARCD1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGR
LLEDS ALSKYDATKQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
Assmann EM, Alborghetti MR, Camargo ME, Kobarg J
The Journal of biological chemistry 2006 Apr 14;281(15):9869-81
The Journal of biological chemistry 2006 Apr 14;281(15):9869-81
No comments: Submit comment
No validations: Submit validation data