HPA022034

antibody from Atlas Antibodies

Targeting: MPRIP M-RIP, p116Rip, RHOIP3

Antibody data

Submit

Validation data

Product number: HPA022034 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA022034, RRID:AB_1854093
Product name: Anti-MPRIP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RVEGHVGELGDFQVKNSQALMCLENCREQLRSLPR ASQEDEQDARAASLASVESALVSAIQALQHWPAPA HGGARAQLETGGTEENGKPASLQQCSQSELTEQEQ VRLLSDQIALEASLISQIADSLKNTT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MPRIP protein structure - HPA022034 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, smooth muscle and testis using Anti-MPRIP antibody HPA022034 (A) shows similar protein distribution across tissues to independent antibody HPA022901 (B).
Antibody #2 product nr: HPA022901
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak cytoplasmic and nucleolar positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-MPRIP antibody HPA022034.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MPRIP antibody HPA022034.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MPRIP antibody HPA022034.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human smooth muscle using Anti-MPRIP antibody HPA022034.
Sample type: HUMAN