Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310158 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dihydropyrimidinase (DPYS) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DPYS antibody: synthetic peptide directed towards the middle region of human DPYS
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQK
ALGKD DFTKIPNGVN- Vial size
- 0.1 mg
Submitted references Middle cerebral artery stenosis increased the risk of vascular disease mortality among type 2 diabetic patients.
Genetic regulation of beta-ureidopropionase and its possible implication in altered uracil catabolism.
Thomas GN, Chen XY, Lin JW, Tomlinson B, Lam WW, Liu R, Yeung VT, Chan JC, Wong KS
Cerebrovascular diseases (Basel, Switzerland) 2008;25(3):261-7
Cerebrovascular diseases (Basel, Switzerland) 2008;25(3):261-7
Genetic regulation of beta-ureidopropionase and its possible implication in altered uracil catabolism.
Thomas HR, Ezzeldin HH, Guarcello V, Mattison LK, Fridley BL, Diasio RB
Pharmacogenetics and genomics 2008 Jan;18(1):25-35
Pharmacogenetics and genomics 2008 Jan;18(1):25-35
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting