Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004896 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004896, RRID:AB_1078643
- Product name
- Anti-DSG2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATM
KGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQ
FTGATGAIMTTETTKTARATGASRDMAGAQAAAVA
LNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQ
EETESLNAS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Intercalated discs: multiple proteins perform multiple functions in non-failing and failing human hearts
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Estigoy C, Pontén F, Odeberg J, Herbert B, Guilhaus M, Charleston M, Ho J, Cameron D, dos Remedios C
Biophysical Reviews 2009 March;1(1):43-49
Biophysical Reviews 2009 March;1(1):43-49
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Asplund A, Gry Björklund M, Sundquist C, Strömberg S, Edlund K, Östman A, Nilsson P, Pontén F, Lundeberg J
British Journal of Dermatology 2008 March;158(3):527-538
British Journal of Dermatology 2008 March;158(3):527-538
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-431.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cell junctions & vesicles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human rectum and liver tissues using Anti-DSG2 antibody. Corresponding DSG2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN