HPA018415

antibody from Atlas Antibodies

Targeting: UPK3A UPK3

Antibody data

Submit

Validation data

Product number: HPA018415 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018415, RRID:AB_1858640
Product name: Anti-UPK3A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYL YVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTG PYKAVAFDLIPCSDLPSLDAIGDVS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

UPK3A protein structure - HPA018415 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human urinary bladder and kidney tissues using Anti-UPK3A antibody. Corresponding UPK3A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and urinary bladder using Anti-UPK3A antibody HPA018415 (A) shows similar protein distribution across tissues to independent antibody HPA018407 (B).
Antibody #2 product nr: HPA018407
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human urinary bladder shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-UPK3A antibody HPA018415.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-UPK3A antibody HPA018415.
Sample type: HUMAN