HPA019033

antibody from Atlas Antibodies

Targeting: COBL KIAA0633

Antibody data

Submit

Validation data

Product number: HPA019033 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019033, RRID:AB_2083648
Product name: Anti-COBL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KSAHHEGRNPLGEGRNQPPTMGMGHVRVPAAHTTE VTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRP HGYAEKGYAGKAPVLAAPPVTVKDDRTSSPHSETQ GWKDGAQWPCVTPPNNHGEDLAVGA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

COBL protein structure - HPA019033 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human parathyroid gland and smooth muscle tissues using Anti-COBL antibody. Corresponding COBL RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, heart muscle and smooth muscle using Anti-COBL antibody HPA019033 (A) shows similar protein distribution across tissues to independent antibody HPA019167 (B).
Antibody #2 product nr: HPA019167
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human smooth muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-COBL antibody HPA019033.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-COBL antibody HPA019033.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle using Anti-COBL antibody HPA019033.
Sample type: HUMAN