HPA026109

antibody from Atlas Antibodies

Targeting: AKAP9 AKAP350, AKAP450, CG-NAP, HYPERION, KIAA0803, LQT11, MU-RMS-40.16A, PPP1R45, PRKA9, YOTIAO

Antibody data

Submit

Validation data

Product number: HPA026109 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026109, RRID:AB_1844688
Product name: Anti-AKAP9
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KLLEAISETSSQLEHAKVTQTELMRESFRQKQEAT ESLKCQEELRERLHEESRAREQLAVELSKAEGVID GYADEKTLFERQIQEKTDIIDRLEQELLCASNRLQ ELEAEQQQIQEERELLSRQKEAMKAEAGPVEQQLL QETE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AKAP9 protein structure - HPA026109 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA026109 antibody. Corresponding AKAP9 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate granular positivity in cytoplasm granular in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate granular positivity in cytoplasm in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak cytoplasmic granular positivity in exocrine glandular cells.
Sample type: HUMAN