HPA004631

antibody from Atlas Antibodies

Targeting: DAZAP1 MGC19907

Antibody data

Submit

Validation data

Product number: HPA004631 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004631, RRID:AB_1078626
Product name: Anti-DAZAP1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFG FVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRG MQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNC GETELREYFKKFGVVTEVVMIYDAEKQRPR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DAZAP1 protein structure - HPA004631 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using Anti-DAZAP1 antibody. Corresponding DAZAP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, skin and testis using Anti-DAZAP1 antibody HPA004631 (A) shows similar protein distribution across tissues to independent antibody HPA004201 (B).
Antibody #2 product nr: HPA004201
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-DAZAP1 antibody HPA004631.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-DAZAP1 antibody HPA004631.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-DAZAP1 antibody HPA004631.
Sample type: HUMAN