Explore
Validate
Learn
Western blot
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002896 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002896, RRID:AB_1079459
- Product name
- Anti-NDRG2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNII
THAPNLDNIELYWNSYNNRRDLNFERGGDITLRCP
VMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADS
GGQP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NDRG2 promotes myoblast proliferation and caspase 3/7 activities during differentiation, and attenuates hydrogen peroxide - But not palmitate-induced toxicity.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
NDRG4 is required for cell cycle progression and survival in glioblastoma cells.
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Frequent promoter hypermethylation and transcriptional downregulation of the gene at 14q11.2 in primary glioblastoma
Anderson KJ, Russell AP, Foletta VC
FEBS open bio 2015;5:668-81
FEBS open bio 2015;5:668-81
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
NDRG4 is required for cell cycle progression and survival in glioblastoma cells.
Schilling SH, Hjelmeland AB, Radiloff DR, Liu IM, Wakeman TP, Fielhauer JR, Foster EH, Lathia JD, Rich JN, Wang XF, Datto MB
The Journal of biological chemistry 2009 Sep 11;284(37):25160-9
The Journal of biological chemistry 2009 Sep 11;284(37):25160-9
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Frequent promoter hypermethylation and transcriptional downregulation of the gene at 14q11.2 in primary glioblastoma
Tepel M, Roerig P, Wolter M, Gutmann D, Perry A, Reifenberger G, Riemenschneider M
International Journal of Cancer 2008 November;123(9):2080-2086
International Journal of Cancer 2008 November;123(9):2080-2086
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-NDRG2 antibody. Corresponding NDRG2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
