Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003203-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003203-M01, RRID:AB_1111898
- Product name
- HOXA6 monoclonal antibody (M01), clone 3A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXA6.
- Antigen sequence
GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVL
ACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPG
DYLHFSPEQQYKPDSSSGQGKALHDEGADR- Isotype
- IgG
- Antibody clone number
- 3A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT.
Gessner A, Thomas M, Castro PG, Büchler L, Scholz A, Brümmendorf TH, Soria NM, Vormoor J, Greil J, Heidenreich O
Leukemia 2010 Oct;24(10):1751-9
Leukemia 2010 Oct;24(10):1751-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol