Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010363-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010363-M01, RRID:AB_1674848
- Product name
- HMG20A monoclonal antibody (M01), clone 4D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HMG20A.
- Antigen sequence
LDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQ
KGKSHRQDAARQATHDHEKETEVKERSVFDIPIFT
EEFLNHSKAREAELRQLRKSNMEFEERNAALQKHV
ESMRT- Isotype
- IgG
- Antibody clone number
- 4D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HMG20A expression in transfected 293T cell line by HMG20A monoclonal antibody (M01), clone 4D5.Lane 1: HMG20A transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HMG20A is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HMG20A on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol