H00054512-M02
antibody from Abnova Corporation
Targeting: EXOSC4
FLJ20591, hRrp41p, p12A, RRP41, RRP41A, Rrp41p, SKI6, Ski6p
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054512-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054512-M02, RRID:AB_1237698
- Product name
- EXOSC4 monoclonal antibody (M02), clone 4F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
- Antigen sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQA
DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA
LVNCQYSSATFSTGERKRRPHGDRKSCEMG- Isotype
- IgG
- Antibody clone number
- 4F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EXOSC4 expression in transfected 293T cell line by EXOSC4 monoclonal antibody (M02), clone 4F9.Lane 1: EXOSC4 transfected lysate(26.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EXOSC4 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol