Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002318-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002318-A01, RRID:AB_489488
- Product name
- FLNC polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant FLNC.
- Antigen sequence
SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDC
SKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVT
YTVKEKGDYILIVKWGDESVPGSPFKVKVP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
Urine proteomics for discovery of improved diagnostic markers of Kawasaki disease.
Sakane A, Alamir Mahmoud Abdallah A, Nakano K, Honda K, Kitamura T, Imoto I, Matsushita N, Sasaki T
Genes to cells : devoted to molecular & cellular mechanisms 2013 Sep;18(9):810-22
Genes to cells : devoted to molecular & cellular mechanisms 2013 Sep;18(9):810-22
Urine proteomics for discovery of improved diagnostic markers of Kawasaki disease.
Kentsis A, Shulman A, Ahmed S, Brennan E, Monuteaux MC, Lee YH, Lipsett S, Paulo JA, Dedeoglu F, Fuhlbrigge R, Bachur R, Bradwin G, Arditi M, Sundel RP, Newburger JW, Steen H, Kim S
EMBO molecular medicine 2013 Feb;5(2):210-20
EMBO molecular medicine 2013 Feb;5(2):210-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FLNC polyclonal antibody (A01), Lot # FAK0070504QCS1 Western Blot analysis of FLNC expression in NIH/3T3 ( Cat # L018V1 ).